Anti TMEM164 pAb (ATL-HPA038784)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038784-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TMEM164
Alternative Gene Name: FLJ22679, RP13-360B22.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047045: 100%, ENSRNOG00000012787: 100%
Entrez Gene ID: 84187
Uniprot ID: Q5U3C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR |
| Gene Sequence | MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR |
| Gene ID - Mouse | ENSMUSG00000047045 |
| Gene ID - Rat | ENSRNOG00000012787 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TMEM164 pAb (ATL-HPA038784) | |
| Datasheet | Anti TMEM164 pAb (ATL-HPA038784) Datasheet (External Link) |
| Vendor Page | Anti TMEM164 pAb (ATL-HPA038784) at Atlas Antibodies |
| Documents & Links for Anti TMEM164 pAb (ATL-HPA038784) | |
| Datasheet | Anti TMEM164 pAb (ATL-HPA038784) Datasheet (External Link) |
| Vendor Page | Anti TMEM164 pAb (ATL-HPA038784) |