Anti TMEM164 pAb (ATL-HPA038784)

Atlas Antibodies

Catalog No.: ATL-HPA038784-25

Protein Description: transmembrane protein 164
Gene Name: TMEM164
Alternative Gene Name: FLJ22679, RP13-360B22.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047045: 100%, ENSRNOG00000012787: 100%
Entrez Gene ID: 84187
Uniprot ID: Q5U3C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
• Gene Sequence: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR
• Gene ID - Mouse: ENSMUSG00000047045
• Gene ID - Rat: ENSRNOG00000012787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.