Anti TMEM139 pAb (ATL-HPA036983 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036983-25

Protein Description: transmembrane protein 139
Gene Name: TMEM139
Alternative Gene Name: FLJ90586
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071506: 54%, ENSRNOG00000028024: 54%
Entrez Gene ID: 135932
Uniprot ID: Q8IV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLRSQLQSMQTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIPPAPEEEQPSHP
• Gene Sequence: GLRSQLQSMQTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIPPAPEEEQPSHP
• Gene ID - Mouse: ENSMUSG00000071506
• Gene ID - Rat: ENSRNOG00000028024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.