Anti TINAG pAb (ATL-HPA035427 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035427-25

Protein Description: tubulointerstitial nephritis antigen
Gene Name: TINAG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032357: 87%, ENSRNOG00000058120: 86%
Entrez Gene ID: 27283
Uniprot ID: Q9UJW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTQPWYPEGCFKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRPELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPM
• Gene Sequence: HTQPWYPEGCFKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRPELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPM
• Gene ID - Mouse: ENSMUSG00000032357
• Gene ID - Rat: ENSRNOG00000058120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.