Anti THOC3 pAb (ATL-HPA044009 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044009-25

Protein Description: THO complex 3
Gene Name: THOC3
Alternative Gene Name: MGC5469, TEX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025872: 100%, ENSRNOG00000000104: 100%
Entrez Gene ID: 84321
Uniprot ID: Q96J01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
• Gene Sequence: HDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
• Gene ID - Mouse: ENSMUSG00000025872
• Gene ID - Rat: ENSRNOG00000000104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti THOC3 pAb (ATL-HPA044009 w/enhanced validation) – 1 Found

Kumar, Raman; Palmer, Elizabeth; Gardner, Alison E; Carroll, Renee; Banka, Siddharth; Abdelhadi, Ola; Donnai, Dian; Elgersma, Ype; Curry, Cynthia J; Gardham, Alice; Suri, Mohnish; Malla, Rishikesh; Brady, Lauren Ilana; Tarnopolsky, Mark; Azmanov, Dimitar N; Atkinson, Vanessa; Black, Michael; Baynam, Gareth; Dreyer, Lauren; Hayeems, Robin Z; Marshall, Christian R; Costain, Gregory; Wessels, Marja W; Baptista, Julia; Drummond, James; Leffler, Melanie; Field, Michael; Gecz, Jozef. Expanding Clinical Presentations Due to Variations in THOC2 mRNA Nuclear Export Factor. Frontiers In Molecular Neuroscience. 13( 32116545):12.