Anti THG1L pAb (ATL-HPA035877)

Atlas Antibodies

Catalog No.: ATL-HPA035877-25

Protein Description: tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
Gene Name: THG1L
Alternative Gene Name: FLJ11601, FLJ20546, ICF45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011254: 72%, ENSRNOG00000005539: 76%
Entrez Gene ID: 54974
Uniprot ID: Q9NWX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
• Gene Sequence: FNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
• Gene ID - Mouse: ENSMUSG00000011254
• Gene ID - Rat: ENSRNOG00000005539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.