Anti TFF3 pAb (ATL-HPA035464 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035464-25

Protein Description: trefoil factor 3 (intestinal)
Gene Name: TFF3
Alternative Gene Name: HITF, ITF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024029: 74%, ENSRNOG00000001159: 74%
Entrez Gene ID: 7033
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECT
• Gene Sequence: SSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECT
• Gene ID - Mouse: ENSMUSG00000024029
• Gene ID - Rat: ENSRNOG00000001159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TFF3 pAb (ATL-HPA035464 w/enhanced validation) – 1 Found

Pinzon-Guzman, Carolina; Sangadala, Sreedhara; Riera, Katherine M; Popova, Evgenya Y; Manning, Elizabeth; Huh, Won Jae; Alexander, Matthew S; Shelton, Julia S; Boden, Scott D; Goldenring, James R. Noggin regulates foregut progenitor cell programming, and misexpression leads to esophageal atresia. The Journal Of Clinical Investigation. 2020;130(8):4396-4410.