Anti TEX37 pAb (ATL-HPA070239)

Atlas Antibodies

Catalog No.: ATL-HPA070239-25

Protein Description: testis expressed 37
Gene Name: TEX37
Alternative Gene Name: C2orf51, FLJ25369, TSC21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051896: 60%, ENSRNOG00000006476: 58%
Entrez Gene ID: 200523
Uniprot ID: Q96LM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCH
• Gene Sequence: GFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCH
• Gene ID - Mouse: ENSMUSG00000051896
• Gene ID - Rat: ENSRNOG00000006476
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.