Anti TEX101 pAb (ATL-HPA042513 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042513-25

Protein Description: testis expressed 101
Gene Name: TEX101
Alternative Gene Name: CT131, MGC4766, SGRG, SPATA44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062773: 67%, ENSRNOG00000020057: 55%
Entrez Gene ID: 83639
Uniprot ID: Q9BY14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHCPTCVALGTCFSAPSLPCPNGTTRCYQGKLEITG
• Gene Sequence: VTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHCPTCVALGTCFSAPSLPCPNGTTRCYQGKLEITG
• Gene ID - Mouse: ENSMUSG00000062773
• Gene ID - Rat: ENSRNOG00000020057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TEX101 pAb (ATL-HPA042513 w/enhanced validation) – 1 Found

Korbakis, Dimitrios; Schiza, Christina; Brinc, Davor; Soosaipillai, Antoninus; Karakosta, Theano D; Légaré, Christine; Sullivan, Robert; Mullen, Brendan; Jarvi, Keith; Diamandis, Eleftherios P; Drabovich, Andrei P. Preclinical evaluation of a TEX101 protein ELISA test for the differential diagnosis of male infertility. Bmc Medicine. 2017;15(1):60.