Anti TEPSIN pAb (ATL-HPA063410)

Atlas Antibodies

Catalog No.: ATL-HPA063410-25

Protein Description: TEPSIN, adaptor related protein complex 4 accessory protein
Gene Name: TEPSIN
Alternative Gene Name: C17orf56, ENTHD2, FLJ31528
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025377: 89%, ENSRNOG00000028161: 90%
Entrez Gene ID: 146705
Uniprot ID: Q96N21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR
• Gene Sequence: LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR
• Gene ID - Mouse: ENSMUSG00000025377
• Gene ID - Rat: ENSRNOG00000028161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.