Anti TDRD6 pAb (ATL-HPA075923 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA075923-25

Protein Description: tudor domain containing 6
Gene Name: TDRD6
Alternative Gene Name: bA446F17.4, CT41.2, NY-CO-45, SPATA36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040140: 54%, ENSRNOG00000025693: 53%
Entrez Gene ID: 221400
Uniprot ID: O60522
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INSSYKELKLLQSLTKTNLVTQYQDSVGNKNSQVFPLTTEKKEEISAETPLKTARVEATLSERKIGDSCDKDLPLKFCEFPQKTI
• Gene Sequence: INSSYKELKLLQSLTKTNLVTQYQDSVGNKNSQVFPLTTEKKEEISAETPLKTARVEATLSERKIGDSCDKDLPLKFCEFPQKTI
• Gene ID - Mouse: ENSMUSG00000040140
• Gene ID - Rat: ENSRNOG00000025693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.