Anti TCTN2 pAb (ATL-HPA039900 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039900-25

Protein Description: tectonic family member 2
Gene Name: TCTN2
Alternative Gene Name: C12orf38, FLJ12975, MKS8, TECT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032560: 24%, ENSRNOG00000052704: 69%
Entrez Gene ID: 79867
Uniprot ID: Q96GX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGGIVTPKVIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQL
• Gene Sequence: LGGIVTPKVIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQL
• Gene ID - Mouse: ENSMUSG00000032560
• Gene ID - Rat: ENSRNOG00000052704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.