Anti TCTEX1D4 pAb (ATL-HPA062652 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062652-25

Protein Description: Tctex1 domain containing 4
Gene Name: TCTEX1D4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047671: 79%, ENSRNOG00000018463: 81%
Entrez Gene ID: 343521
Uniprot ID: Q5JR98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRAME
• Gene Sequence: SRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRAME
• Gene ID - Mouse: ENSMUSG00000047671
• Gene ID - Rat: ENSRNOG00000018463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.