Anti TCP11L2 pAb (ATL-HPA039483)

Atlas Antibodies

Catalog No.:
ATL-HPA039483-25
Immunohistochemical staining of human tonsil shows distinct positivity in plasma.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: t-complex 11, testis-specific-like 2
Gene Name: TCP11L2
Alternative Gene Name: MGC40368
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020034: 81%, ENSRNOG00000007587: 81%
Entrez Gene ID: 255394
Uniprot ID: Q8N4U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACLSLITNNMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQ
Gene Sequence ACLSLITNNMVGAITGGLPELASRLTRISAVLLEGMNKETFNLKEVLNSIGIQTCVEVNKTLMERGLPTLNAEIQ
Gene ID - Mouse ENSMUSG00000020034
Gene ID - Rat ENSRNOG00000007587
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCP11L2 pAb (ATL-HPA039483)
Datasheet Anti TCP11L2 pAb (ATL-HPA039483) Datasheet (External Link)
Vendor Page Anti TCP11L2 pAb (ATL-HPA039483) at Atlas Antibodies

Documents & Links for Anti TCP11L2 pAb (ATL-HPA039483)
Datasheet Anti TCP11L2 pAb (ATL-HPA039483) Datasheet (External Link)
Vendor Page Anti TCP11L2 pAb (ATL-HPA039483)
!