Anti TCP1 pAb (ATL-HPA031082 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031082-25

Protein Description: t-complex 1
Gene Name: TCP1
Alternative Gene Name: CCT1, Ccta, D6S230E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068039: 93%, ENSRNOG00000014160: 95%
Entrez Gene ID: 6950
Uniprot ID: P17987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY
• Gene Sequence: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY
• Gene ID - Mouse: ENSMUSG00000068039
• Gene ID - Rat: ENSRNOG00000014160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TCP1 pAb (ATL-HPA031082 w/enhanced validation) – 1 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.