Anti TCOF1 pAb (ATL-HPA038237)

Atlas Antibodies

Catalog No.: ATL-HPA038237-25

Protein Description: Treacher Collins-Franceschetti syndrome 1
Gene Name: TCOF1
Alternative Gene Name: TCS, treacle
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024613: 44%, ENSRNOG00000026108: 52%
Entrez Gene ID: 6949
Uniprot ID: Q13428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
• Gene Sequence: KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
• Gene ID - Mouse: ENSMUSG00000024613
• Gene ID - Rat: ENSRNOG00000026108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TCOF1 pAb (ATL-HPA038237) – 6 Found

Lambert, Jean-Philippe; Picaud, Sarah; Fujisawa, Takao; Hou, Huayun; Savitsky, Pavel; Uusküla-Reimand, Liis; Gupta, Gagan D; Abdouni, Hala; Lin, Zhen-Yuan; Tucholska, Monika; Knight, James D R; Gonzalez-Badillo, Beatriz; St-Denis, Nicole; Newman, Joseph A; Stucki, Manuel; Pelletier, Laurence; Bandeira, Nuno; Wilson, Michael D; Filippakopoulos, Panagis; Gingras, Anne-Claude. Interactome Rewiring Following Pharmacological Targeting of BET Bromodomains. Molecular Cell. 2019;73(3):621-638.e17. 

Larsen, Dorthe H; Hari, Flurina; Clapperton, Julie A; Gwerder, Myriam; Gutsche, Katrin; Altmeyer, Matthias; Jungmichel, Stephanie; Toledo, Luis I; Fink, Daniel; Rask, Maj-Britt; Grøfte, Merete; Lukas, Claudia; Nielsen, Michael L; Smerdon, Stephen J; Lukas, Jiri; Stucki, Manuel. The NBS1-Treacle complex controls ribosomal RNA transcription in response to DNA damage. Nature Cell Biology. 2014;16(8):792-803. 

Velichko, Artem K; Petrova, Nadezhda V; Luzhin, Artem V; Strelkova, Olga S; Ovsyannikova, Natalia; Kireev, Igor I; Petrova, Natalia V; Razin, Sergey V; Kantidze, Omar L. Hypoosmotic stress induces R loop formation in nucleoli and ATR/ATM-dependent silencing of nucleolar transcription. Nucleic Acids Research. 2019;47(13):6811-6825. 

Korsholm, Lea M; Gál, Zita; Lin, Lin; Quevedo, Oliver; Ahmad, Diana A; Dulina, Ekaterina; Luo, Yonglun; Bartek, Jiri; Larsen, Dorthe H. Double-strand breaks in ribosomal RNA genes activate a distinct signaling and chromatin response to facilitate nucleolar restructuring and repair. Nucleic Acids Research. 2019;47(15):8019-8035. 

Mooser, Clémence; Symeonidou, Ioanna-Eleni; Leimbacher, Pia-Amata; Ribeiro, Alison; Shorrocks, Ann-Marie K; Jungmichel, Stephanie; Larsen, Sara C; Knechtle, Katja; Jasrotia, Arti; Zurbriggen, Diana; Jeanrenaud, Alain; Leikauf, Colin; Fink, Daniel; Nielsen, Michael L; Blackford, Andrew N; Stucki, Manuel. Treacle controls the nucleolar response to rDNA breaks via TOPBP1 recruitment and ATR activation. Nature Communications. 2020;11(1):123. 

Tsaridou, Stavroula; Velimezi, Georgia; Willenbrock, Frances; Chatzifrangkeskou, Maria; Elsayed, Waheba; Panagopoulos, Andreas; Karamitros, Dimitris; Gorgoulis, Vassilis; Lygerou, Zoi; Roukos, Vassilis; O'Neill, Eric; Pefani, Dafni Eleftheria. 53BP1-mediated recruitment of RASSF1A to ribosomal DNA breaks promotes local ATM signaling. Embo Reports. 2022;23(8):e54483.