Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016604-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/83532/152074/atl-hpa016604_anti-tcl1a-pab-atl-hpa016604-wenhanced-validation_33703__49019.1681101965.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TCL1A
Alternative Gene Name: TCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041359: 52%, ENSRNOG00000025233: 53%
Entrez Gene ID: 8115
Uniprot ID: P56279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLE |
| Gene Sequence | AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLE |
| Gene ID - Mouse | ENSMUSG00000041359 |
| Gene ID - Rat | ENSRNOG00000025233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) | |
| Datasheet | Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) | |
| Datasheet | Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) |
| Citations for Anti TCL1A pAb (ATL-HPA016604 w/enhanced validation) – 2 Found |
| Mansouri, Mahmoud R; Sevov, Marie; Aleskog, Anna; Jondal, Mikael; Merup, Mats; Sundström, Christer; Osorio, Lyda; Rosenquist, Richard. IGHV3-21 gene usage is associated with high TCL1 expression in chronic lymphocytic leukemia. European Journal Of Haematology. 2010;84(2):109-16. PubMed |
| Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911. PubMed |