Anti TCHP pAb (ATL-HPA038638)

Atlas Antibodies

Catalog No.: ATL-HPA038638-25

Protein Description: trichoplein, keratin filament binding
Gene Name: TCHP
Alternative Gene Name: MGC10854, TpMs
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002486: 76%, ENSRNOG00000001191: 76%
Entrez Gene ID: 84260
Uniprot ID: Q9BT92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQ
• Gene Sequence: MEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQ
• Gene ID - Mouse: ENSMUSG00000002486
• Gene ID - Rat: ENSRNOG00000001191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TCHP pAb (ATL-HPA038638) – 1 Found

Lauriola, Angela; Martello, Andrea; Fantini, Sebastian; Marverti, Gaetano; Zanocco-Marani, Tommaso; Davalli, Pierpaola; Guardavaccaro, Daniele; Mai, Sabine; Caporali, Andrea; D'Arca, Domenico. Depletion of Trichoplein (TpMs) Causes Chromosome Mis-Segregation, DNA Damage and Chromosome Instability in Cancer Cells. Cancers. 2020;12(4)