Anti TBXAS1 pAb (ATL-HPA031259 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031259-25

Protein Description: thromboxane A synthase 1 (platelet)
Gene Name: TBXAS1
Alternative Gene Name: CYP5, CYP5A1, THAS, TS, TXAS, TXS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029925: 50%, ENSRNOG00000007918: 52%
Entrez Gene ID: 6916
Uniprot ID: P24557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI
• Gene Sequence: RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI
• Gene ID - Mouse: ENSMUSG00000029925
• Gene ID - Rat: ENSRNOG00000007918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.