Anti TBC1D5 pAb (ATL-HPA035126 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035126-25

Protein Description: TBC1 domain family, member 5
Gene Name: TBC1D5
Alternative Gene Name: KIAA0210
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023923: 96%, ENSRNOG00000010637: 95%
Entrez Gene ID: 9779
Uniprot ID: Q92609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQL
• Gene Sequence: DVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQL
• Gene ID - Mouse: ENSMUSG00000023923
• Gene ID - Rat: ENSRNOG00000010637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.