Anti TBC1D23 pAb (ATL-HPA038152)

Atlas Antibodies

Catalog No.: ATL-HPA038152-100

Protein Description: TBC1 domain family, member 23
Gene Name: TBC1D23
Alternative Gene Name: FLJ11046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022749: 78%, ENSRNOG00000001642: 98%
Entrez Gene ID: 55773
Uniprot ID: Q9NUY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDRVGKPYRGVKPVFSIGDEEEY
• Gene Sequence: VDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRMSFNLPWPDRSCTERHVSSSDRVGKPYRGVKPVFSIGDEEEY
• Gene ID - Mouse: ENSMUSG00000022749
• Gene ID - Rat: ENSRNOG00000001642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.