Anti-TBC1D22A pAb (ATL-HPA078026)

Atlas Antibodies

Catalog No.:
ATL-HPA078026-100
Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human TBC1D22A, Gene description: TBC1 domain family member 22A, Alternative Gene Names: C22orf4, Validated applications: WB, IHC, Uniprot ID: Q8WUA7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQR
Gene Sequence PLLHGTLLRSTAKMPTTPVKAKRVSTFQEFESNTSDAWDAGEDDDELLAMAAESLNSEVVMETANRVLRNHSQR
Gene ID - Mouse ENSMUSG00000051864
Gene ID - Rat ENSRNOG00000017057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-TBC1D22A pAb (ATL-HPA078026)
Vendor Page Anti-TBC1D22A pAb (ATL-HPA078026) at Atlas Antibodies

Documents & Links for Anti-TBC1D22A pAb (ATL-HPA078026)
Vendor Page Anti-TBC1D22A pAb (ATL-HPA078026)
!