Anti TBC1D21 pAb (ATL-HPA043319 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043319-25

Protein Description: TBC1 domain family, member 21
Gene Name: TBC1D21
Alternative Gene Name: MGC34741, MgcRabGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036244: 89%, ENSRNOG00000008737: 85%
Entrez Gene ID: 161514
Uniprot ID: Q8IYX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYFSWQSSQDER
• Gene Sequence: TLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYFSWQSSQDER
• Gene ID - Mouse: ENSMUSG00000036244
• Gene ID - Rat: ENSRNOG00000008737
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.