Anti TBC1D12 pAb (ATL-HPA038645)

Atlas Antibodies

Catalog No.: ATL-HPA038645-25

Protein Description: TBC1 domain family, member 12
Gene Name: TBC1D12
Alternative Gene Name: KIAA0608
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048720: 70%, ENSRNOG00000036598: 70%
Entrez Gene ID: 23232
Uniprot ID: O60347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVGPEDAGACSGRNPKLLPVPAPDPVGQDRKVIRATGGFGGGVGAVEPPEEADEEE
• Gene Sequence: MVGPEDAGACSGRNPKLLPVPAPDPVGQDRKVIRATGGFGGGVGAVEPPEEADEEE
• Gene ID - Mouse: ENSMUSG00000048720
• Gene ID - Rat: ENSRNOG00000036598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.