Anti TAZ pAb (ATL-HPA039557 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039557-25

Protein Description: tafazzin
Gene Name: TAZ
Alternative Gene Name: BTHS, CMD3A, EFE, EFE2, G4.5, XAP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009995: 95%, ENSRNOG00000053023: 95%
Entrez Gene ID: 6901
Uniprot ID: Q16635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
• Gene Sequence: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
• Gene ID - Mouse: ENSMUSG00000009995
• Gene ID - Rat: ENSRNOG00000053023
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAZ pAb (ATL-HPA039557 w/enhanced validation) – 3 Found

Pathak, Surajit; Meng, Wen-Jian; Zhang, Hong; Gnosa, Sebastian; Nandy, Suman Kumar; Adell, Gunnar; Holmlund, Birgitta; Sun, Xiao-Feng. Tafazzin protein expression is associated with tumorigenesis and radiation response in rectal cancer: a study of Swedish clinical trial on preoperative radiotherapy. Plos One. 9(5):e98317. 

Enzo, Elena; Santinon, Giulia; Pocaterra, Arianna; Aragona, Mariaceleste; Bresolin, Silvia; Forcato, Mattia; Grifoni, Daniela; Pession, Annalisa; Zanconato, Francesca; Guzzo, Giulia; Bicciato, Silvio; Dupont, Sirio. Aerobic glycolysis tunes YAP/TAZ transcriptional activity. The Embo Journal. 2015;34(10):1349-70. 

Wen, Yugang; Zhao, Senlin; Holmqvist, Annica; Hahn-Stromberg, Victoria; Adell, Gunnar; Holmlund, Birgitta; Pathak, Surajit; Peng, Zhihai; Sun, Xiao-Feng. Predictive Role of Biopsy Based Biomarkers for Radiotherapy Treatment in Rectal Cancer. Journal Of Personalized Medicine. 2020;10(4)