Anti TANK pAb (ATL-HPA037675)

Atlas Antibodies

Catalog No.: ATL-HPA037675-25

Protein Description: TRAF family member-associated NFKB activator
Gene Name: TANK
Alternative Gene Name: I-TRAF, TRAF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064289: 71%, ENSRNOG00000008859: 71%
Entrez Gene ID: 10010
Uniprot ID: Q92844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSIT
• Gene Sequence: IRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSIT
• Gene ID - Mouse: ENSMUSG00000064289
• Gene ID - Rat: ENSRNOG00000008859
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.