Anti TAF8 pAb (ATL-HPA031730 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031730-100

Protein Description: TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Gene Name: TAF8
Alternative Gene Name: FLJ32821, TAF(II)43, TBN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023980: 99%, ENSRNOG00000015249: 100%
Entrez Gene ID: 129685
Uniprot ID: Q7Z7C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
• Gene Sequence: PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL
• Gene ID - Mouse: ENSMUSG00000023980
• Gene ID - Rat: ENSRNOG00000015249
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.