Anti TAB2 pAb (ATL-HPA070137)

Atlas Antibodies

Catalog No.: ATL-HPA070137-25

Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 93%, ENSRNOG00000016054: 90%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
• Gene Sequence: HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
• Gene ID - Mouse: ENSMUSG00000015755
• Gene ID - Rat: ENSRNOG00000016054
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.