Anti SYT1 pAb (ATL-HPA008394 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008394-25

Protein Description: synaptotagmin I
Gene Name: SYT1
Alternative Gene Name: P65, SVP65, SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035864: 100%, ENSRNOG00000006426: 100%
Entrez Gene ID: 6857
Uniprot ID: P21579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQ
• Gene Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQ
• Gene ID - Mouse: ENSMUSG00000035864
• Gene ID - Rat: ENSRNOG00000006426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYT1 pAb (ATL-HPA008394 w/enhanced validation) – 1 Found

Yang, Ji'an; Yang, Qian. Identification of Core Genes and Screening of Potential Targets in Glioblastoma Multiforme by Integrated Bioinformatic Analysis. Frontiers In Oncology. 10( 33718116):615976.