Anti SYNGAP1 pAb (ATL-HPA038373 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038373-25

Protein Description: synaptic Ras GTPase activating protein 1
Gene Name: SYNGAP1
Alternative Gene Name: KIAA1938, RASA5, SYNGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067629: 100%, ENSRNOG00000000483: 100%
Entrez Gene ID: 8831
Uniprot ID: Q96PV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
• Gene Sequence: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
• Gene ID - Mouse: ENSMUSG00000067629
• Gene ID - Rat: ENSRNOG00000000483
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYNGAP1 pAb (ATL-HPA038373 w/enhanced validation) – 1 Found

Li, Lili; Fan, Yichao; Huang, Xin; Luo, Jie; Zhong, Lan; Shu, Xing-Sheng; Lu, Li; Xiang, Tingxiu; Chan, Anthony T C; Yeo, Winnie; Chen, Ceshi; Chan, Wai Yee; Huganir, Richard L; Tao, Qian. Tumor Suppression of Ras GTPase-Activating Protein RASA5 through Antagonizing Ras Signaling Perturbation in Carcinomas. Iscience. 2019;21( 31654850):1-18.