Anti SUGT1 pAb (ATL-HPA043949)

Atlas Antibodies

Catalog No.: ATL-HPA043949-100

Protein Description: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Gene Name: SUGT1
Alternative Gene Name: SGT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022024: 99%, ENSRNOG00000012594: 99%
Entrez Gene ID: 10910
Uniprot ID: Q9Y2Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK
• Gene Sequence: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK
• Gene ID - Mouse: ENSMUSG00000022024
• Gene ID - Rat: ENSRNOG00000012594
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.