Anti SUCLG1 pAb (ATL-HPA036684 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036684-25

Protein Description: succinate-CoA ligase, alpha subunit
Gene Name: SUCLG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052738: 93%, ENSRNOG00000005587: 94%
Entrez Gene ID: 8802
Uniprot ID: P53597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIM
• Gene Sequence: ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIM
• Gene ID - Mouse: ENSMUSG00000052738
• Gene ID - Rat: ENSRNOG00000005587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.