Anti STYXL1 pAb (ATL-HPA050261)

Atlas Antibodies

Catalog No.: ATL-HPA050261-25

Protein Description: serine/threonine/tyrosine interacting-like 1
Gene Name: STYXL1
Alternative Gene Name: DUSP24, MK-STYX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019178: 63%, ENSRNOG00000023366: 63%
Entrez Gene ID: 51657
Uniprot ID: Q9Y6J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKD
• Gene Sequence: PGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKD
• Gene ID - Mouse: ENSMUSG00000019178
• Gene ID - Rat: ENSRNOG00000023366
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.