Anti STX16 pAb (ATL-HPA041019)

Atlas Antibodies

Catalog No.: ATL-HPA041019-25

Protein Description: syntaxin 16
Gene Name: STX16
Alternative Gene Name: hsyn16, SYN16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027522: 98%, ENSRNOG00000005281: 87%
Entrez Gene ID: 8675
Uniprot ID: O14662
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHR
• Gene Sequence: SPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHR
• Gene ID - Mouse: ENSMUSG00000027522
• Gene ID - Rat: ENSRNOG00000005281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STX16 pAb (ATL-HPA041019) – 1 Found

Pruikkonen, Sofia; Kallio, Marko J. Excess of a Rassf1-targeting microRNA, miR-193a-3p, perturbs cell division fidelity. British Journal Of Cancer. 2017;116(11):1451-1461.