Anti STIP1 pAb (ATL-HPA039291 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039291-25

Protein Description: stress-induced phosphoprotein 1
Gene Name: STIP1
Alternative Gene Name: HOP, STI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024966: 94%, ENSRNOG00000021164: 95%
Entrez Gene ID: 10963
Uniprot ID: P31948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD
• Gene Sequence: EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD
• Gene ID - Mouse: ENSMUSG00000024966
• Gene ID - Rat: ENSRNOG00000021164
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.