Anti STARD4 pAb (ATL-HPA046177)

Atlas Antibodies

SKU: ATL-HPA046177-25

• 
• 

Protein Description: StAR-related lipid transfer (START) domain containing 4
Gene Name: STARD4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024378: 85%, ENSRNOG00000020468: 86%
Entrez Gene ID: 134429
Uniprot ID: Q96DR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP
• Gene Sequence: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGP
• Gene ID - Mouse: ENSMUSG00000024378
• Gene ID - Rat: ENSRNOG00000020468
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.