Anti STAMBP pAb (ATL-HPA035800)

Atlas Antibodies

Catalog No.: ATL-HPA035800-25

Protein Description: STAM binding protein
Gene Name: STAMBP
Alternative Gene Name: AMSH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006906: 75%, ENSRNOG00000012227: 74%
Entrez Gene ID: 10617
Uniprot ID: O95630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQP
• Gene Sequence: QQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQP
• Gene ID - Mouse: ENSMUSG00000006906
• Gene ID - Rat: ENSRNOG00000012227
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.