Anti STAM2 pAb (ATL-HPA035529 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035529-25

Protein Description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
Gene Name: STAM2
Alternative Gene Name: Hbp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055371: 69%, ENSRNOG00000027447: 63%
Entrez Gene ID: 10254
Uniprot ID: O75886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP
• Gene Sequence: PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP
• Gene ID - Mouse: ENSMUSG00000055371
• Gene ID - Rat: ENSRNOG00000027447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.