Anti STAC pAb (ATL-HPA035143)

Atlas Antibodies

Catalog No.: ATL-HPA035143-25

Protein Description: SH3 and cysteine rich domain
Gene Name: STAC
Alternative Gene Name: STAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032502: 80%, ENSRNOG00000008865: 83%
Entrez Gene ID: 6769
Uniprot ID: Q99469
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY
• Gene Sequence: GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY
• Gene ID - Mouse: ENSMUSG00000032502
• Gene ID - Rat: ENSRNOG00000008865
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.