Anti ST7 pAb (ATL-HPA038326)

Atlas Antibodies

Catalog No.: ATL-HPA038326-25

Protein Description: suppression of tumorigenicity 7
Gene Name: ST7
Alternative Gene Name: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021685: 29%, ENSRNOG00000054157: 29%
Entrez Gene ID: 7982
Uniprot ID: Q9NRC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQ
• Gene Sequence: THQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQ
• Gene ID - Mouse: ENSMUSG00000021685
• Gene ID - Rat: ENSRNOG00000054157
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.