Anti SSC4D pAb (ATL-HPA062611)

Atlas Antibodies

Catalog No.: ATL-HPA062611-25

Protein Description: scavenger receptor cysteine rich family, 4 domains
Gene Name: SSC4D
Alternative Gene Name: S4D-SRCRB, SRCRB-S4D, SRCRB4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029699: 94%, ENSRNOG00000001435: 92%
Entrez Gene ID: 136853
Uniprot ID: Q8WTU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP
• Gene Sequence: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP
• Gene ID - Mouse: ENSMUSG00000029699
• Gene ID - Rat: ENSRNOG00000001435
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.