Anti SRPX2 pAb (ATL-HPA038786)

Atlas Antibodies

Catalog No.: ATL-HPA038786-100

Protein Description: sushi-repeat containing protein, X-linked 2
Gene Name: SRPX2
Alternative Gene Name: SRPUL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031253: 92%, ENSRNOG00000003715: 94%
Entrez Gene ID: 27286
Uniprot ID: O60687
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFIT
• Gene Sequence: ESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFIT
• Gene ID - Mouse: ENSMUSG00000031253
• Gene ID - Rat: ENSRNOG00000003715
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.