Anti SREK1 pAb (ATL-HPA037674 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037674-100

Protein Description: splicing regulatory glutamine/lysine-rich protein 1
Gene Name: SREK1
Alternative Gene Name: DKFZp564B176, SFRS12, SRrp508, SRrp86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032621: 100%, ENSRNOG00000032735: 100%
Entrez Gene ID: 140890
Uniprot ID: Q8WXA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRV
• Gene Sequence: KQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRV
• Gene ID - Mouse: ENSMUSG00000032621
• Gene ID - Rat: ENSRNOG00000032735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.