Anti SPPL2A pAb (ATL-HPA067304)

Atlas Antibodies

Catalog No.: ATL-HPA067304-25

Protein Description: signal peptide peptidase like 2A
Gene Name: SPPL2A
Alternative Gene Name: IMP3, PSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027366: 79%, ENSRNOG00000011652: 73%
Entrez Gene ID: 84888
Uniprot ID: Q8TCT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
• Gene Sequence: KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
• Gene ID - Mouse: ENSMUSG00000027366
• Gene ID - Rat: ENSRNOG00000011652
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.