Anti SPOCK2 pAb (ATL-HPA044605 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044605-25

Protein Description: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Gene Name: SPOCK2
Alternative Gene Name: KIAA0275, testican-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058297: 86%, ENSRNOG00000061544: 85%
Entrez Gene ID: 9806
Uniprot ID: Q92563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
• Gene Sequence: EQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDS
• Gene ID - Mouse: ENSMUSG00000058297
• Gene ID - Rat: ENSRNOG00000061544
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPOCK2 pAb (ATL-HPA044605 w/enhanced validation) – 2 Found

Ngo, Debby; Wen, Donghai; Gao, Yan; Keyes, Michelle J; Drury, Erika R; Katz, Dan H; Benson, Mark D; Sinha, Sumita; Shen, Dongxiao; Farrell, Laurie A; Peterson, Bennet D; Friedman, David J; Elmariah, Sammy; Young, Bessie A; Smith, J Gustav; Yang, Qiong; Vasan, Ramachandran S; Larson, Martin G; Correa, Adolfo; Humphreys, Benjamin D; Wang, Thomas J; Pollak, Martin R; Wilson, James G; Gerszten, Robert E; Rhee, Eugene P. Circulating testican-2 is a podocyte-derived marker of kidney health. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2020;117(40):25026-25035. 

Pedrosa, Rute M S M; Wismans, Leonoor V; Sinke, Renata; van der Weiden, Marcel; van Eijck, Casper H J; Kros, Johan M; Mustafa, Dana A M. Differential Expression of BOC, SPOCK2, and GJD3 Is Associated with Brain Metastasis of ER-Negative Breast Cancers. Cancers. 2021;13(12)