Anti SPINK9 pAb (ATL-HPA038288)

Atlas Antibodies

Catalog No.: ATL-HPA038288-25

Protein Description: serine peptidase inhibitor, Kazal type 9
Gene Name: SPINK9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060201: 38%, ENSRNOG00000032873: 38%
Entrez Gene ID: 643394
Uniprot ID: Q5DT21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVH
• Gene Sequence: KQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVH
• Gene ID - Mouse: ENSMUSG00000060201
• Gene ID - Rat: ENSRNOG00000032873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.