Anti SPINK13 pAb (ATL-HPA036456)

Atlas Antibodies

Catalog No.: ATL-HPA036456-25

Protein Description: serine peptidase inhibitor, Kazal type 13 (putative)
Gene Name: SPINK13
Alternative Gene Name: HBVDNAPTP1, HESPINTOR, LiESP6, MGC149260, SPINK5L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073551: 57%, ENSRNOG00000038793: 53%
Entrez Gene ID: 153218
Uniprot ID: Q1W4C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRI
• Gene Sequence: FNKRDFTRWPKPRCKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRI
• Gene ID - Mouse: ENSMUSG00000073551
• Gene ID - Rat: ENSRNOG00000038793
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPINK13 pAb (ATL-HPA036456) – 2 Found

Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11) 

Liang, Jiaqi; Chen, Zhencong; Huang, Yiwei; Bi, Guoshu; Bian, Yunyi; Jin, Xing; Zhang, Huan; Sui, Qihai; Zhan, Cheng; Wang, Qun. Signatures of malignant cells and novel therapeutic targets revealed by single-cell sequencing in lung adenocarcinoma. Cancer Medicine. 2022;11(11):2244-2258.