Anti SPHKAP pAb (ATL-HPA048168 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA048168-25

Protein Description: SPHK1 interactor, AKAP domain containing
Gene Name: SPHKAP
Alternative Gene Name: SKIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026163: 79%, ENSRNOG00000016388: 80%
Entrez Gene ID: 80309
Uniprot ID: Q2M3C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHP
• Gene Sequence: AQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLKRKKESQGSGTAVRKHKPPRLSEIKRKTDEHP
• Gene ID - Mouse: ENSMUSG00000026163
• Gene ID - Rat: ENSRNOG00000016388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.