Anti SPERT pAb (ATL-HPA039359 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039359-25

Protein Description: spermatid associated
Gene Name: SPERT
Alternative Gene Name: CBY2, NURIT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034913: 71%, ENSRNOG00000047413: 71%
Entrez Gene ID: 220082
Uniprot ID: Q8NA61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAY
• Gene Sequence: NKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAY
• Gene ID - Mouse: ENSMUSG00000034913
• Gene ID - Rat: ENSRNOG00000047413
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.