Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039606-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SPEF2
Alternative Gene Name: CT122, FLJ23577, KPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072663: 82%, ENSRNOG00000058275: 78%
Entrez Gene ID: 79925
Uniprot ID: Q9C093
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPQPPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQ |
| Gene Sequence | VPQPPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQ |
| Gene ID - Mouse | ENSMUSG00000072663 |
| Gene ID - Rat | ENSRNOG00000058275 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) | |
| Datasheet | Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) | |
| Datasheet | Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) |
| Citations for Anti SPEF2 pAb (ATL-HPA039606 w/enhanced validation) – 2 Found |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |
| Mori, Mayako; Kido, Takashi; Sakamoto, Noriho; Ozasa, Mutsumi; Kido, Kumiko; Noguchi, Yasuko; Tokito, Takatomo; Okuno, Daisuke; Yura, Hirokazu; Hara, Atsuko; Ishimoto, Hiroshi; Suematsu, Takashi; Obase, Yasushi; Tanaka, Yoshimasa; Izumikawa, Koichi; Takeuchi, Kazuhiko; Mukae, Hiroshi. Novel SPEF2 Variant in a Japanese Patient with Primary Ciliary Dyskinesia: A Case Report and Literature Review. Journal Of Clinical Medicine. 2022;12(1) PubMed |