Anti SPDYC pAb (ATL-HPA039891)

Atlas Antibodies

Catalog No.: ATL-HPA039891-25

Protein Description: speedy/RINGO cell cycle regulator family member C
Gene Name: SPDYC
Alternative Gene Name: Ringo2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029148: 28%, ENSRNOG00000050570: 28%
Entrez Gene ID: 387778
Uniprot ID: Q5MJ68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPLVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKY
• Gene Sequence: SPLVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKY
• Gene ID - Mouse: ENSMUSG00000029148
• Gene ID - Rat: ENSRNOG00000050570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.